Protein Info for Shew_2366 in Shewanella loihica PV-4

Annotation: 3-oxoacyl-(acyl carrier protein) synthase III (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 3 to 320 (318 residues), 337.6 bits, see alignment E=3.5e-105 PF00108: Thiolase_N" amino acids 42 to 141 (100 residues), 35.7 bits, see alignment E=9.6e-13 PF08545: ACP_syn_III" amino acids 104 to 181 (78 residues), 106.8 bits, see alignment E=6.2e-35 PF08541: ACP_syn_III_C" amino acids 231 to 320 (90 residues), 114 bits, see alignment E=4.4e-37

Best Hits

Swiss-Prot: 61% identical to FABH2_VIBCH: 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2 (fabH2) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to slo:Shew_2366)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFI4 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Shew_2366 3-oxoacyl-(acyl carrier protein) synthase III (RefSeq) (Shewanella loihica PV-4)
MQYATITGWGKCVPPATLTNHDLATFIDTSDEWIKPRTGISQRHISHVNTSELATVAAQR
ALAAAGVKGEEIDLIILATASPDTLIPNIASTVQANIGASCGAFDINAACSGFLYGLGLA
SSQIKSGQSKKVLVIGAERLSFYLDWSRRETAVLFGDGAGAVVVEATDQPGGVLGYELNN
DPAGRDILKAGFGTAMDRFNAASLDFYIEFNGQEIFKRAIAGMGKLSNTVLEKCGVDKDE
VDLVIPHQANERIIDTLINRMKIPKEKAVVNIANYGNTSAATIPIAICDALEKGLIKPNQ
TILSCAFGAGLTSAAVLFKWGERVTPISESDAELPPCEQTGIELVKRAVNYFCGE