Protein Info for Shew_2346 in Shewanella loihica PV-4

Annotation: ABC transporter-related protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF00005: ABC_tran" amino acids 18 to 149 (132 residues), 72.5 bits, see alignment E=2.8e-24

Best Hits

KEGG orthology group: K02041, phosphonate transport system ATP-binding protein (inferred from 100% identity to slo:Shew_2346)

Predicted SEED Role

"Phosphonate ABC transporter ATP-binding protein (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFG4 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Shew_2346 ABC transporter-related protein (RefSeq) (Shewanella loihica PV-4)
MLQIESLSLSYRETRVIDDLDLSIKRGESLAIVGPSGAGKSTLLSYIYEQLKQDAALCSQ
SQGLVDALSVFHNVYMGALARHSFAYNLLNLAWPLAARREEVAKLCAELYLEAPLQKPVS
SLSGGQRQRVALARALYQQKPSFIGDESFSALDPVMAQRLLSLVKARHETVIMVLHDSDL
ALSHFDRIIGLSEGKLVLDKPTCELDGEQLACFFDNQMATS