Protein Info for Shew_2341 in Shewanella loihica PV-4

Annotation: two component, sigma54 specific, Fis family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF00072: Response_reg" amino acids 8 to 117 (110 residues), 93.3 bits, see alignment E=3.3e-30 PF00158: Sigma54_activat" amino acids 146 to 313 (168 residues), 240.8 bits, see alignment E=2e-75 PF14532: Sigma54_activ_2" amino acids 147 to 317 (171 residues), 72.6 bits, see alignment E=1.2e-23 PF25601: AAA_lid_14" amino acids 318 to 381 (64 residues), 70.8 bits, see alignment E=2.1e-23 PF02954: HTH_8" amino acids 408 to 447 (40 residues), 43.3 bits, see alignment 7.4e-15

Best Hits

Swiss-Prot: 41% identical to ATOC_ECOLI: Regulatory protein AtoC (atoC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2341)

Predicted SEED Role

"Sigma-54 dependent DNA-binding response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFF9 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Shew_2341 two component, sigma54 specific, Fis family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MEQPKLHILVVEDEPDQRALIVQMLTANQYLVESADSVEQAIVMIKASAPDLVFSDWKLG
QLTGMDLLNYVRREHPDMGFIIATAYGTITHAVDAMQAGADDYLAKPYQRQSLLLAIEKV
AKSIALKRQNRRLSSELSQQQELVGLVGRSALMQKVYQRVQRVSATDATVLIGGESGTGK
ELAARALYQLSARSHKPFVAINCGAIPESLAEAELFGAEKGAYTGANTQKIGKLEAADGG
TVFLDEIGELPLLQQTKLLRFLQEGVISRLGQNSEIKLDVRVIAATHRDLQQEVAEGRFR
EDLYYRLNVVPIHMPALRERPEDIGRLVEHFLKLHANQYGMEVPKLSRDTLKSLLDHSWP
GNVRELANRIERFVLLGDEEEMVQELGAAPQPLDTKRFVLPEAGIEWESFEKDCLRQALD
RFEGNRTKAAKCLGLSYKAFLYRLEKYQLV