Protein Info for Shew_2322 in Shewanella loihica PV-4

Annotation: NnrS family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 62 to 79 (18 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details amino acids 221 to 253 (33 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 329 to 349 (21 residues), see Phobius details amino acids 354 to 381 (28 residues), see Phobius details PF05940: NnrS" amino acids 15 to 384 (370 residues), 369.7 bits, see alignment E=1e-114

Best Hits

KEGG orthology group: K07234, uncharacterized protein involved in response to NO (inferred from 100% identity to slo:Shew_2322)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFE0 at UniProt or InterPro

Protein Sequence (390 amino acids)

>Shew_2322 NnrS family protein (RefSeq) (Shewanella loihica PV-4)
MLNIDEPAHLQPKLALLRLGFRPFFLFGALFSLVALALWGSFLTGRLGFTPHGNPLWWHG
HEMLFGFVMAIVAGFLLTASQTWTGQKSIKGWPLGALFLLWLAPRILLANNQWGSFEVVA
MLDLLFAPAAALVLARQVIAVKQWRNFAFIPILLLLTVANALSYYGVSSQNSLLVSHAFH
GATILMVTIVALIGGRVIPFFTDRATQWQRLDNISWLEKLTFVSLMALFIAMLIGQSLAI
MLCAAVAGITLLVRWSRWGVQSTFGVPLLWSLHLSYLCIPVGLLLIAVGASVSAGLHAMT
VGGLGGMILAMMARVSLGHTGRNLLPPKVMTGAFALILISTITRVLASLFPAQFMLWLTI
ALVAWIFAFGTFVICYAPILLTPRVDGRPG