Protein Info for Shew_2313 in Shewanella loihica PV-4

Name: hscA
Annotation: chaperone protein HscA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 620 PF00012: HSP70" amino acids 21 to 604 (584 residues), 619.2 bits, see alignment E=6.6e-190 TIGR01991: Fe-S protein assembly chaperone HscA" amino acids 21 to 619 (599 residues), 869.6 bits, see alignment E=6e-266 PF06723: MreB_Mbl" amino acids 125 to 377 (253 residues), 60 bits, see alignment E=1.9e-20

Best Hits

Swiss-Prot: 100% identical to HSCA_SHELP: Chaperone protein HscA homolog (hscA) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K04044, molecular chaperone HscA (inferred from 100% identity to slo:Shew_2313)

Predicted SEED Role

"Chaperone protein HscA" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFD1 at UniProt or InterPro

Protein Sequence (620 amino acids)

>Shew_2313 chaperone protein HscA (RefSeq) (Shewanella loihica PV-4)
MALLQIAEPGQSAAPHQHRLAVGIDLGTTNSLVAAVRSGVADTLADESGRHALASVVRYS
EDGVQVGVDAERFSAQDPLNTVVSVKRFMGRSLSDIQAKDASLPYNFSASENGLPLFNTQ
AGQFNPIQISADILRPLVDRAEKTLGGSLEGVVITVPAYFDDAQRQGTKEAASLLGVKVL
RLLNEPTAAAIAYGLDSGQEGVIAIYDLGGGTFDISILRLNKGVFEVLATGGDSALGGDD
FDHALAAHLQESWQLTSLTASERRALLIESRRVKEALTEQASVTASLTLEQGIVHEQVVD
KAQFDALIESLVKKTIASCRRALRDAAISNDEVLETVMVGGSTRVPLVRERVEGFFGKAP
LTSIDPDRVVAIGAAIQADILVGNKPESDLLLLDVIPLSLGIETMGGLVEKVVSRNTTIP
VARAQEFTTFKDGQTAMAFHVVQGERELVADCRSLARFTLKGIPPMAAGAAHIRVTFQVD
ADGLLSVTAMEKSSGVQASIQVKPSFGLTDEEIGTMLKDSMAHAKEDIERRMLAEQQVEA
ARVLESLSAALAKDGDLLDEAEAATIQAGMANLAQVASQSDTDAIEKAIAALDDASQDFA
AKRMDNSIRLALKGQSVDNI