Protein Info for Shew_2293 in Shewanella loihica PV-4

Annotation: tryptophan halogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF04820: Trp_halogenase" amino acids 6 to 196 (191 residues), 141.2 bits, see alignment E=2.4e-45 amino acids 203 to 495 (293 residues), 247.7 bits, see alignment E=1.2e-77

Best Hits

KEGG orthology group: K14266, FADH2 O2-dependent halogenase I [EC: 1.14.14.7] (inferred from 100% identity to slo:Shew_2293)

Predicted SEED Role

"Tryptophan halogenase"

Isozymes

Compare fitness of predicted isozymes for: 1.14.14.7

Use Curated BLAST to search for 1.14.14.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFB1 at UniProt or InterPro

Protein Sequence (537 amino acids)

>Shew_2293 tryptophan halogenase (RefSeq) (Shewanella loihica PV-4)
MSILSIAIVGGGASGWLAANHLGLALKGSSPKVSITLIESPDVPTIGVGEGTVPMIRKSL
QAFGIEETALFRRCDASFKQSIKFINWRHRAPGSEMSAFHHLFDPPSPFGVDLSDFWLDG
LAKGENPMGFDEALSPQRYSCEAQKAPKTLASAPYQGAHAYAYHFDAAKFAELLRENAIE
CFGVEHIQDHLLEVETGRLETGRRGTDSVETDMLTEGNESKNDKKIVALHLREGGRRCFD
FYLDCSGFSGLLMEKALGVEFISLADKLWMNKALVTQVASAPNAPLPPYTQASAHQAGWI
WDIALPKRRGVGLVYCDRYLSDDEARRKLKRYLGDELPSAGEFRSLTMRVGHLQKFWQGN
CVALGLAQGFLEPLEATSILLTDFAASLLARKFPTDSETLPVLEARFNRIVGHAWQAVID
FVALHYQLSDRSDSAFWRDYRTHLSAQPASEELARRLALWQHFTPHPDDFFSQFEVFGVD
NYLYLLYGMGFSTQPKALDDAARQQAWAQLDKIAHAKAFLAQKLPDHRAFIRALIQG