Protein Info for Shew_2282 in Shewanella loihica PV-4

Annotation: Fis family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 PF00158: Sigma54_activat" amino acids 190 to 356 (167 residues), 238.1 bits, see alignment E=1.3e-74 PF14532: Sigma54_activ_2" amino acids 192 to 360 (169 residues), 56 bits, see alignment E=1.7e-18 PF00004: AAA" amino acids 213 to 331 (119 residues), 21.2 bits, see alignment E=1e-07 PF07728: AAA_5" amino acids 213 to 332 (120 residues), 23.6 bits, see alignment E=1.3e-08 PF25601: AAA_lid_14" amino acids 361 to 426 (66 residues), 70.2 bits, see alignment E=3.3e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2282)

Predicted SEED Role

"Formate hydrogenlyase transcriptional activator" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFA0 at UniProt or InterPro

Protein Sequence (507 amino acids)

>Shew_2282 Fis family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MQKQFYFEATQRLCSSLELEQSLRAYFEYVRQHLPIDGIYLNIYRPEYGDIQFLAHVDEA
QTTALNKQVKISAEMEALLSQPDRPVIRIINDLEHDQVTGFVAPQVIPNIQSVILLRMLS
GNTHLGVVGFYAKQKAQFCHRHAELIEPHKDTLSLITAFNLKGRNLLRANQALTQQNRLL
KQAFNPCGVIGADSGLKRVMTQVEAIAKLHTSVLILGETGCGKEVIANAVHCKSQRADKP
FIKVNCGAIPESLIDSELFGYEKGAFTGAEHRKAGFFEQANGGTIFLDEIGELPLSVQVR
LLRVLQNGTITRVGGFDAINLDIRVIAATHRNLQAMVKKQTFREDLWYRLAVFPIEIPSL
RQRRSDIPLLVQHFIEVLAAKFNLDKLPRVSSEQLDSLNHYHWPGNVRELINVLERAMIE
APEGPLNFNLTQVDKVEPAASGKHETIIIDPSHASDKLVPLDVMVSKYIAHAMRITGGKL
YGPGGAAEMLDINPNTLRSKMKKLGLC