Protein Info for Shew_2281 in Shewanella loihica PV-4

Annotation: flavocytochrome c (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF01494: FAD_binding_3" amino acids 50 to 208 (159 residues), 22.3 bits, see alignment E=2.9e-08 PF01134: GIDA" amino acids 51 to 86 (36 residues), 19.9 bits, see alignment 1.4e-07 PF07992: Pyr_redox_2" amino acids 51 to 286 (236 residues), 31.7 bits, see alignment E=4.4e-11 PF00890: FAD_binding_2" amino acids 51 to 493 (443 residues), 263.3 bits, see alignment E=1.9e-81 TIGR01813: flavocytochrome c" amino acids 51 to 505 (455 residues), 495.4 bits, see alignment E=7e-153 PF01266: DAO" amino acids 51 to 258 (208 residues), 53 bits, see alignment E=1.6e-17 PF12831: FAD_oxidored" amino acids 51 to 250 (200 residues), 48.7 bits, see alignment E=2.9e-16 PF13450: NAD_binding_8" amino acids 54 to 89 (36 residues), 29.8 bits, see alignment 2.5e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2281)

Predicted SEED Role

"Flavocytochrome c flavin subunit" in subsystem Flavocytochrome C

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QF99 at UniProt or InterPro

Protein Sequence (519 amino acids)

>Shew_2281 flavocytochrome c (RefSeq) (Shewanella loihica PV-4)
MKQKDLISPGRRQLLKGGAAMAVSVAGLGAMSAQAAECSGDKPPHFDEIVDVLVIGSGFA
GMSAALQAKEAGASVMVIDKMPVFGGNSTINGGAMAVAGSKLQAKEGIKDSVDTMVADML
KAGRGMNDVEMLKLVCNGTAESCQWLEAYGVEWKPFVQHFGGHSLPRVLQTVQSSGAGII
RPLIKAAKQHGIEMRNQTKLESFVKDPAGRVIGVQVRDGYYFPQERTGKMRLIGARKGVI
MATGGFSRDLEYRQMQQPELNGDLDSTNHPGATSEALKQMMLIGANPIHLDQIQLGPWAS
PDEKGFGTASQFNTIATYPSGIVVDVRTGERFFNELADRKARADAIMTRRDDQGNPVYPV
GFTNAKGAAQAQTLEWGLKYKVIQKADTLEELAALYQIPAKALKAQVARWNDAVKAGEDK
EFGRPMQKAMALEEGPWYGVRMWPKVHYCMGGVKVNTQSQVLHLVSNEPIDGLYAAGEAT
GGIHGASRLGACAVAEGVVTGRNAGRICAASAAIELKQA