Protein Info for Shew_2213 in Shewanella loihica PV-4

Annotation: lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details TIGR02208: lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase" amino acids 8 to 311 (304 residues), 435.1 bits, see alignment E=7.3e-135 PF03279: Lip_A_acyltrans" amino acids 12 to 302 (291 residues), 234.4 bits, see alignment E=8.5e-74

Best Hits

KEGG orthology group: K02560, lipid A biosynthesis (KDO)2-(lauroyl)-lipid iva acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to slo:Shew_2213)

Predicted SEED Role

"Lipid A biosynthesis (KDO) 2-(lauroyl)-lipid IVA acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QF31 at UniProt or InterPro

Protein Sequence (311 amino acids)

>Shew_2213 lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase (RefSeq) (Shewanella loihica PV-4)
MSRKPKYFDRRFRAELLHPKHWPTWFAIGVLVFFGLMPAWLRDPIARLLARLVKKIAKKP
LKVARANLETCFPDKSKAEIDKLLDENIESFVLILLAQSELLLRSDANLRRRVQLDGFEH
VQRARDAGQPVIFIMPHVWGIEYAGLRLNLELPMVTMAKAHRNKLFDWFNNRMRSSKGGN
VYMREAGIRALLSELKNDNSFFYLPDEDLGPEKSVFAPFLGTVKATLPVVGRLASAGNAQ
VMPVKIGYDQQKRQYLLTVLPPISPEEMQGKENEALALNRAVEQVINAYPEQYMWFLKLL
RTRPPGEASLY