Protein Info for Shew_2211 in Shewanella loihica PV-4

Annotation: phosphoribosylaminoimidazole-succinocarboxamidesynthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 TIGR02735: phosphoribosylaminoimidazole-succinocarboxamide synthase" amino acids 4 to 366 (363 residues), 671.2 bits, see alignment E=1.5e-206 PF01259: SAICAR_synt" amino acids 47 to 295 (249 residues), 129.3 bits, see alignment E=1e-41

Best Hits

Swiss-Prot: 86% identical to PUR7_SHEPA: Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC) from Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)

KEGG orthology group: K01923, phosphoribosylaminoimidazole-succinocarboxamide synthase [EC: 6.3.2.6] (inferred from 100% identity to slo:Shew_2211)

Predicted SEED Role

"Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)" in subsystem De Novo Purine Biosynthesis (EC 6.3.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QF29 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Shew_2211 phosphoribosylaminoimidazole-succinocarboxamidesynthase (RefSeq) (Shewanella loihica PV-4)
MNQSNKVLAVNDDLPIRTDKPVHSGKVRSVYWLTAEDSARLIEQKGYDVPADTPLAIMVI
SDRISAFDCIWQGENGLNGVPGKGAALNAISNHWFKLFKEKGLADSHILDVPHPFVWIVQ
KAQPVMVEAIARQYITGSMWRAYSKGERDFCGITLPEGLEKDQKLEEVLITPSTKGVLTG
LEGVPEADDVNVSRADLERHLEGFNFHSKGDIDLYEKLLKEGFAVISEALAEQDQIFVDT
KFEFGYVKDASGQEKLIYMDEVGTPDSSRIWDGEARRNGKIVEKSKEGFRQWLLNHFPDP
DILLNKERMPERFALARDNKLPTEVMMDISNTYVGIAETIIGHKLHLSENPRQEIIDILR
DEYQLIQA