Protein Info for Shew_2202 in Shewanella loihica PV-4

Annotation: 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00977: His_biosynth" amino acids 1 to 233 (233 residues), 250.9 bits, see alignment E=5.3e-79 TIGR00007: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase" amino acids 2 to 238 (237 residues), 252.9 bits, see alignment E=1.5e-79

Best Hits

Swiss-Prot: 100% identical to HIS4_SHELP: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (hisA) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K01814, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC: 5.3.1.16] (inferred from 100% identity to slo:Shew_2202)

MetaCyc: 59% identical to 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (Escherichia coli K-12 substr. MG1655)
isomerase. [EC: 5.3.1.16]

Predicted SEED Role

"Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16)" in subsystem Histidine Biosynthesis (EC 5.3.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QF20 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Shew_2202 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (RefSeq) (Shewanella loihica PV-4)
MIIPAIDLIEGQVVRLYQGDYAQQTTFDLSPLAQLQAYQAQGATWLHIVDLTGAKDPDRR
QTRLIGELVENLEANIQVGGGIRSEAQVKELLDLGVKRVVIGSLAVKQPELVQSWLETYG
SDAICLALDVNINQAGEKIVAVSGWQSGGGKTLESLVATFAPYGLKHALVTDISRDGTLQ
GSNTQLYQEIVARYPDIEWQASGGIATLDDVSAVRNSGASGIIIGKALLINNFTVQEAIA
CWPNA