Protein Info for Shew_2194 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 137 to 154 (18 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details amino acids 278 to 295 (18 residues), see Phobius details PF00892: EamA" amino acids 22 to 150 (129 residues), 59.3 bits, see alignment E=2.3e-20 amino acids 165 to 290 (126 residues), 68.7 bits, see alignment E=2.9e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2194)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QF12 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Shew_2194 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MSQSRAQSQPLSQSPSHLSSQAVMMALGSAILMGTIGALARTANLEASIITFYRLLIGAA
CLIAYMLATGKARQILHRPGKRHLFNGAMLAGFMVFYVQSIGYINMANAVMLIYLAPLVS
AIGAHFLFHERLTRQDLLAIGIALIGVVAILPSLESLTGSTAELKGYGFALLALLSYSGF
MLINRRPASASPYQSTLIQLSFGALCLLPFALHQAVMPSLTQWFWLALIGVFPGFLAILF
AVKALRVLPAATFGTLAYIEPVTVVILGWSLFAEHLTPMQLMGCGLIICAGLIQTRKRRR
APRPQ