Protein Info for Shew_2193 in Shewanella loihica PV-4

Annotation: peptidase M22, glycoprotease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03725: tRNA threonylcarbamoyl adenosine modification protein YeaZ
  • amino acids 13 to 235 (223 residues), 200.8 bits, E=1.3e-63
• PF00814: TsaD
  • amino acids 40 to 240 (201 residues), 112.5 bits, E=1.6e-36

Best Hits

KEGG orthology group: K14742, hypothetical protease [EC: 3.4.-.-] (inferred from 100% identity to slo:Shew_2193)

Predicted SEED Role

"TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA"

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

See A3QF11 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Shew_2193 peptidase M22, glycoprotease (RefSeq) (Shewanella loihica PV-4)
MPENKDFSAPLSLLALDTCTEFCSVALQYQGQVFAREADAPREHSQRLLPMVQEVLQEAG
IALSQVDVIAYGRGPGSFTGIRICTSMTQGLALGQDLPVVGISTLAAMAQAAIEIKGATQ
VATAIDARMGEIYYGEYLSVDGLASLVGEEQVCAPEQKLSELGANAQAVSGLDFSAPIAA
CGTGFDAYPALVTEAMTLVEEAKFPLARHMLPLAEAAVNAGQATDVDQLKPVYLRDTVTW
KKLPGRE