Protein Info for Shew_2191 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 134 to 151 (18 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details PF13398: Peptidase_M50B" amino acids 22 to 218 (197 residues), 146.3 bits, see alignment E=5.1e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2191)

Predicted SEED Role

"Tlr1621 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QF09 at UniProt or InterPro

Protein Sequence (233 amino acids)

>Shew_2191 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MAFSIDSPSSRAGMPTRSLFMVEMLLALVVTRIPYLSVPFKWLESYFHEASHALATLFSG
GIVSHIELYPNGAGLCVSQGGWPVLIGFAGYFGAALWGLLIFHLATWARGIRVSFSCLGL
VVLLSIVLWGRGLLTVAILLMLALLFLLPLKLSHSPLLTFALRVMALMVMLNALASPTVL
LGMPGRGDAAMLAEQTWIPAWIWVGIWLLTSLTMLWLCWRRVDSANQLSTQKV