Protein Info for Shew_2175 in Shewanella loihica PV-4

Name: nhaB
Annotation: sodium/proton antiporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 206 to 224 (19 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 304 to 334 (31 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details amino acids 393 to 417 (25 residues), see Phobius details amino acids 456 to 475 (20 residues), see Phobius details amino acids 482 to 502 (21 residues), see Phobius details PF06450: NhaB" amino acids 1 to 516 (516 residues), 965 bits, see alignment E=1.1e-294 TIGR00774: Na+/H+ antiporter NhaB" amino acids 1 to 516 (516 residues), 890.4 bits, see alignment E=2.3e-272 PF03600: CitMHS" amino acids 70 to 347 (278 residues), 72.4 bits, see alignment E=3.8e-24

Best Hits

Swiss-Prot: 100% identical to NHAB_SHELP: Na(+)/H(+) antiporter NhaB (nhaB) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03314, Na+:H+ antiporter, NhaB family (inferred from 100% identity to slo:Shew_2175)

Predicted SEED Role

"Na+/H+ antiporter NhaB" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEZ3 at UniProt or InterPro

Protein Sequence (531 amino acids)

>Shew_2175 sodium/proton antiporter (RefSeq) (Shewanella loihica PV-4)
MPVTMSQAFIDNFLGNSPKWFKIAILSFLVINPIVFYLNPFVAGWLLVVEFIFTLAMALK
CYPLQPGGLLAIEAVIIGMTSPSQVLHEIEANLEVLLLLIFMVAGIYFMKQLLLFVFTKM
ITKIRSKVVVSLMFCIASAFLSAFLDALTVIAVIIAVAVGFYSIYHKVASGKSFTDDHDH
TSDSHGEGHSLCEDELEAFRGFLRNLLMHAGIGTALGGVCTMVGEPQNLIIAAQANWQFG
EFALRMGPVTVPVFISGIATCFLVEKFKWFGYGQQLPEAVHKILSDYASYEDAHRTKHDK
IKLVIQAFVGVWLIVGLAFHLASVGLIGLSVIILTTAFNGVTNEHALGKAFEEALPFTAL
LAVFFAIVGVIIDQQLFAPVIQWALSYEGNTQLVIFYIANGLLSMVSDNVFVGTVYINEV
KAALLDGQITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSAIAPLIRLSYGRMVW
MALPYTIVLSIVGILAIETGFLGEMTQYFYDSHMLIHHSVAEAAKGAVTGH