Protein Info for Shew_2160 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01887: putative dipeptidase" amino acids 107 to 542 (436 residues), 238.6 bits, see alignment E=8.2e-75 PF01546: Peptidase_M20" amino acids 137 to 542 (406 residues), 59.4 bits, see alignment E=5e-20 PF07687: M20_dimer" amino acids 333 to 372 (40 residues), 23.7 bits, see alignment 4e-09

Best Hits

KEGG orthology group: K01270, aminoacylhistidine dipeptidase [EC: 3.4.13.3] (inferred from 100% identity to slo:Shew_2160)

Predicted SEED Role

"Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.13.3

Use Curated BLAST to search for 3.4.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEX8 at UniProt or InterPro

Protein Sequence (578 amino acids)

>Shew_2160 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MTLKLSLKAAGAFSLLLCSGLTFATSQADSHLSAQGDSAVSAKPPLQAAPKISALADRVA
QYALNTYGDETISALSTLIPFKTVETEGMTPLTHPEFIGFKAQLKSLSQSLGLDYSDQGY
VVLIGLGEGEQKLGVITHGDVQPADASFWQQDPFTLDSQSQPGFLIGRGTEDDKGAIVTA
MYAMKAIKDKGLALNRRIELLVYLAEESDWAPLKAFLTDFTPADINITIDAEYPVVTAEK
GWSEIRLTIPKMPKTPKMPKMPKNGKAASSASASLDGFSGGAFDSQVPQQAVAKISGLDK
KTIAALKDKASAQQGMKYQFEQTSSEGQVNGQLTITAEGKSTHSSTPEAGVNAVTHLAEL
LKGIHFARSESAMTAKFIQQMVGLGLYGEQFGDIAYEDDFMGPMTLAATLVKPNDQGTEI
VLNLRRPVGKTPEQLDLETHQALEGWQAQHQVSLEGIETYWGEPKLMDKAPHLQTLLSVF
GHFTDTPSPRPVAIGGSTNSKLFPNALSFGPAMPGVEYTGHSEHEFITKAQFMLNLQMYT
AAFVELAASTEELSEQAKQGTKQKTKQAAKTGAQRTSD