Protein Info for Shew_2145 in Shewanella loihica PV-4

Annotation: MscS mechanosensitive ion channel (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 207 to 228 (22 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 276 to 298 (23 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 343 to 362 (20 residues), see Phobius details PF21088: MS_channel_1st" amino acids 324 to 364 (41 residues), 29.7 bits, see alignment 8e-11 PF00924: MS_channel_2nd" amino acids 366 to 431 (66 residues), 61 bits, see alignment E=1.4e-20 PF21082: MS_channel_3rd" amino acids 444 to 525 (82 residues), 27.8 bits, see alignment E=4.2e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2145)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEW3 at UniProt or InterPro

Protein Sequence (537 amino acids)

>Shew_2145 MscS mechanosensitive ion channel (RefSeq) (Shewanella loihica PV-4)
MRFVVWQFMLVMSFFVGSAWSAAPNSLVGALSDAAADSGQSQFVRSVEHFDYQDSLQRDT
PRGTVEGFMEAVYEQDYEKAAEYLDLRYLPEGMSASKGAEYAKQLQLIIERNLWLDLGQL
NDTPLGQDNDQLPAYRDLFGRVALQSDQIALYLQRVPSEGGTIWKVSNATVAKVPQLYQN
LGYGPVAEWFVNHIPEGRWFNVNLWEWTLLLAYLITAFLVMVPITWIIKRVILLTQYELK
EELAYIVAGPLRLLAAVLLVRAWVSHSSISPAAIEMIDTGFLLVSAIIWFGWSAMGIFQQ
GLKKRWKEQGKDQAASLLRPLTNFLRVIFVIMAVLLWLEHLGFNASAIIAGMGIGGIAIA
LASKQSIENFIGTITLYSAAPIKVGNLCKFGSISGTVEEIGLRCTQIRTLDRTLIHVPNA
KLVEMEIENISQREKIRFKADIRLDYAVTTSEQLKAIVAEIKAMLEEHELVLKEPLRVTF
KGFGLHGLQVNVLAYIGTKSFPTFQLASEELHLKIMDIVVKNGSRIVPVAPVALNNG