Protein Info for Shew_2141 in Shewanella loihica PV-4

Annotation: lytic murein transglycosylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02283: lytic murein transglycosylase" amino acids 25 to 321 (297 residues), 368.5 bits, see alignment E=1.3e-114 PF13406: SLT_2" amino acids 26 to 317 (292 residues), 384 bits, see alignment E=4.5e-119 PF01471: PG_binding_1" amino acids 338 to 392 (55 residues), 42.4 bits, see alignment 6.7e-15

Best Hits

KEGG orthology group: K08305, membrane-bound lytic murein transglycosylase B [EC: 3.2.1.-] (inferred from 100% identity to slo:Shew_2141)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEV9 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Shew_2141 lytic murein transglycosylase (RefSeq) (Shewanella loihica PV-4)
MKKLLTFASLILATGLPSLSALAQDFDTCVSALKQKALAAGVSSKTVEEGLGQVKYVARV
IELDKKQPEFSQTFDNYFSKRVTDWRVQEGRRLLKQHGQLLHKLQQEYGIPPQYLVAFWG
LETNFGSYKGKMPVIDSLTTLACDPRRSDYFTGELIQALKLKEAYQFDNAQMQGSWAGAM
GHTQFMPSAYAKYAVDADGDGKADLFNSTQDALSSAANFLNNLGWMRNERWGREVSLPKD
YDYRHLGRNDKQSLTTWAGLGITQANGRALSTPDMQAALYLPAGHTGPAFLGYGNFDVIM
RWNRSEFYAIAVGHLADRINGGARLHVAPPKHDNISRAKLKQLQAKLNEKGYEVGKPDGV
LGVNSRAGLQAFQRSVGLVADGFPSDETFSALGIK