Protein Info for Shew_2137 in Shewanella loihica PV-4

Annotation: glutathione S-transferase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF13409: GST_N_2" amino acids 60 to 164 (105 residues), 44.2 bits, see alignment E=4.6e-15 PF00043: GST_C" amino acids 200 to 287 (88 residues), 33.1 bits, see alignment E=1.1e-11 PF13410: GST_C_2" amino acids 209 to 281 (73 residues), 58.9 bits, see alignment E=8.6e-20 PF14497: GST_C_3" amino acids 218 to 291 (74 residues), 26.3 bits, see alignment E=1.5e-09

Best Hits

KEGG orthology group: K07393, putative glutathione S-transferase (inferred from 100% identity to slo:Shew_2137)

Predicted SEED Role

"Glutathione S-transferase, omega (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEV5 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Shew_2137 glutathione S-transferase domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MGLLQGGQWVDKWYDTDKSKGAFEREDAAFRRWIKAPSADEPEPEFKAESGRYHLYVSLA
CPWAHRTLIFRELKSLQAHIGVTVVEPHMLSNGWEFSGPKQSEIAQHIEGSEIDRLNGKD
YLYQIYQLAKPDYSGRVTVPVLWDKQRRTIVSNESAEIIRMFNSAFNEITGNHLDFYPAA
HSEEIDEINHWIYHKINNGVYRAGFATTQAAYEQAFDELFDALDSLETRLSQQRYLVGDQ
ITEADWRLFTTLVRFDAVYVGHFKTNRNRIADMPSIQAYLKELYQHPGVAKTVNFEHIKQ
HYYFSHGQINPTRVVPKGPRLDLDSLHGRDQLFKNKLGR