Protein Info for Shew_2123 in Shewanella loihica PV-4

Annotation: putative sulfite oxidase subunit YedY (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00174: Oxidored_molyb
  • amino acids 110 to 269 (160 residues), 126.2 bits, E=5.1e-41

Best Hits

Swiss-Prot: 61% identical to MSRP_SERP5: Protein-methionine-sulfoxide reductase catalytic subunit MsrP (msrP) from Serratia proteamaculans (strain 568)

KEGG orthology group: K07147, (no description) (inferred from 100% identity to slo:Shew_2123)

MetaCyc: 59% identical to protein-L-methionine sulfoxide reductase catalytic subunit MsrP (Escherichia coli K-12 substr. MG1655)
1.8.5.M7 [EC: 1.8.5.M7]; 1.8.5.M7 [EC: 1.8.5.M7]

Predicted SEED Role

"Putative sulfite oxidase subunit YedY"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.M7

Sequence Analysis Tools

See A3QEU1 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Shew_2123 putative sulfite oxidase subunit YedY (RefSeq) (Shewanella loihica PV-4)
MGTGRKAWQEKSALVTPEAVFNDRRNIIKALGLGALGASIPGQVQAGLFDLFGKSEPHAP
FVTHPLAFSGNKAYGQQEILTPEKKVTTHNNYYEFGTSKTDPFDNAQGFKVDPWTLRVEG
LVDNPLTLDLDDLTKLLPLEERIYRLRCVEAWSMVIPWVGFPLKALLAKAGVKAGATHVA
FETLFDPDQMPGQKSRLMGGGIHYPYVEGLRLDEATNELAFMAVGLYGKTLPPQNGAPIR
LVVPWKYGFKSIKSVVRIRVMDKQPPTSWNQLAPHEYGFYANVNPEVDHPRWSQATERRI
GEGGIFSAQRIATLPFNGYGEQVAHLYKGMNLRQYY