Protein Info for Shew_2119 in Shewanella loihica PV-4

Annotation: methyl-accepting chemotaxis sensory transducer (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details PF08269: dCache_2" amino acids 44 to 198 (155 residues), 121 bits, see alignment E=1.4e-38 PF17200: sCache_2" amino acids 45 to 193 (149 residues), 124 bits, see alignment E=1.3e-39 PF17201: Cache_3-Cache_2" amino acids 97 to 191 (95 residues), 41.2 bits, see alignment E=3.3e-14 PF00672: HAMP" amino acids 214 to 267 (54 residues), 44.1 bits, see alignment 5.3e-15 PF00015: MCPsignal" amino acids 331 to 514 (184 residues), 147.1 bits, see alignment E=1.2e-46

Best Hits

Swiss-Prot: 38% identical to MCPP_PSEPK: Methyl-accepting chemotaxis protein McpP (mcpP) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to slo:Shew_2119)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QET7 at UniProt or InterPro

Protein Sequence (548 amino acids)

>Shew_2119 methyl-accepting chemotaxis sensory transducer (RefSeq) (Shewanella loihica PV-4)
MNAIYALFRKFKIAHRLLFMLLLAIVATGIMFVFALANIEEVLVKEKQAKLSALSDVGEK
VISQFYEASQAGSMSEEEAKRNAIAALDALRYEGNEYFWTIDRQGIMVQHAFAKKLVGTN
VLGMKDPNGVRLFEKMVTGTANSDYALIEYMWNRPNASAPSPKMSVVKRFTPWGWIVGTG
IYVDDIQEEMQAFIYKYLLICIAVWLPVILILGVISRSISAPMADTIAAFENIARGEGDL
TLRLEESGRDELKQVAASFNEFVAKIQALVNSVSASVTHSRELAEGLADISAQASMVTAN
MQAETQSVATAINEMSMASSEVASNAQLAADSAGSADGEADDTVAVVDGAVAKIKGLSNE
LEVTADEAQALQISSGKIGQILDVIVGIAEQTNLLALNAAIEAARAGEAGRGFAVVADEV
RTLASRTQESTQEINAIIEAIRASVDSVNASVARAKAQSEQTVGETSQVVEALQTIKSSI
RQISDMNIQIATATEEQSAVIAELNMNVTRINDISLENQQKSEEIGSTSEQIKSGSADLE
SLISTFKL