Protein Info for Shew_2116 in Shewanella loihica PV-4

Annotation: AsmA family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 614 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF05170: AsmA" amino acids 2 to 249 (248 residues), 135.7 bits, see alignment E=2.4e-43 amino acids 325 to 517 (193 residues), 104 bits, see alignment E=9e-34

Best Hits

KEGG orthology group: K07289, AsmA protein (inferred from 100% identity to slo:Shew_2116)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QET4 at UniProt or InterPro

Protein Sequence (614 amino acids)

>Shew_2116 AsmA family protein (RefSeq) (Shewanella loihica PV-4)
MKFVKWLLIVFASLFLLLIAYLTLIFDPNDFKPQIVEAVKKQTGRDLVIKQDLSWTFFPS
IGIALGDISLSNPEGFKHDTMLKVDGIVAEVALMPLLSKEVEIAQLNLDGLTLNFDSYKN
GRSSMDGLTSTGEKADKAGDKTGSDGAAQVSVQLSSLNIGGIAITNTQVNLYDEATGKTQ
ALTLESLTLGEFSLGQFADLGYKFSMTQPEMKVSSQGKGQIKVDPSLAKIAIKDFEIENS
LEGDAIPNKRMNINLTTQLELDNNAKTMALVLSSLNVEQIKAQGKMSVNYGAKVPDVVAS
MSFGDVDVTPFMAKDDGTKGEDKTAKGEGTAPAKEPDLSGMKAVNLKLDLDAKSVTADKI
KTENWLMKLTLKNGVLDVSQLSAELYQGKLLASAQLDGRKPVASYRFNKKISGIKVRPLL
TDAAEVDMLAGTTNFEVTGSGYSLIPDNIKRNLDAKGQFEIADGALYGVNIPQMLRDAKA
KLGGNLNAASSGEKKTDFTSLTGSFTVAKGIVNNPDLNMASPLIRLQGKGNVNLLSEAID
YALKTSVVGSLEGQGGAEKDVLYGIEIPFAIAGTISEPKFSLDTAALFDAKLKKETEKAT
DELKDKLFKKLGGL