Protein Info for Shew_2111 in Shewanella loihica PV-4

Annotation: DNA polymerase III, epsilon subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 TIGR00573: exonuclease, DNA polymerase III, epsilon subunit family" amino acids 9 to 225 (217 residues), 225.3 bits, see alignment E=6.4e-71 TIGR01406: DNA polymerase III, epsilon subunit" amino acids 9 to 241 (233 residues), 292.4 bits, see alignment E=2.5e-91 PF00929: RNase_T" amino acids 11 to 178 (168 residues), 134 bits, see alignment E=3.8e-43

Best Hits

Swiss-Prot: 57% identical to DPO3E_SALTY: DNA polymerase III subunit epsilon (dnaQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 100% identity to slo:Shew_2111)

MetaCyc: 56% identical to DNA polymerase III subunit epsilon (Escherichia coli K-12 substr. MG1655)
3.1.11.-

Predicted SEED Role

"DNA polymerase III epsilon subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QES9 at UniProt or InterPro

Protein Sequence (242 amino acids)

>Shew_2111 DNA polymerase III, epsilon subunit (RefSeq) (Shewanella loihica PV-4)
MNIISNAKRQVILDTETTGMNQGAGAVYFGHRIIEIGCVEVINRKLTGRHFHEYINPMQA
IDEEAITVHGITNEFVADKPVFAQIAPAFLEFIDGAEIVAHNANFDVSFMDHEFSLLTPR
GPKTTDICQVLDSLEIAKFLHPGQKNNLDALCKRYGIDNSRRELHGALLDAEILADVYLI
MTGGQTKFELSNEKPGQESGGIIRLANNRPSLKVIGASADELNMHEQRLDLVEKSGQCIW
RG