Protein Info for Shew_2094 in Shewanella loihica PV-4

Annotation: UBA/THIF-type NAD/FAD binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00899: ThiF
  • amino acids 11 to 253 (243 residues), 227.5 bits, E=6.7e-72

Best Hits

KEGG orthology group: K03148, adenylyltransferase [EC: 2.7.7.-] (inferred from 100% identity to slo:Shew_2094)

Predicted SEED Role

"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of siderophore group nonribosomal peptides
• Lipopolysaccharide biosynthesis
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

See A3QER2 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Shew_2094 UBA/THIF-type NAD/FAD binding protein (RefSeq) (Shewanella loihica PV-4)
MSLNDSAFIRYSRQIMLPEVGELGQQRLMEASVAIVGVGGLGQLCAQYLSAAGIGQLTLI
DDDKVELSNLPRQLLFSHDDCGQYKAEVARDRLVGKGTGDNSQVSAFGQIAAKVVRLELH
NAESLLSGVDLVLDCCDNFATRQHINAACVALSTPNVVAAAAHFAGQLMAFDLSKSPNSG
CYHCLFPAELRVSENCSTIGVLGPMVGTMASMQALLAIKLLLGLPGLGQVHRFDGLTGEM
RKLTLRRDHKCSVCAAIKESNIKAYAACGELACSSALGENDE