Protein Info for Shew_2082 in Shewanella loihica PV-4

Annotation: putative methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 TIGR00452: tRNA (mo5U34)-methyltransferase" amino acids 7 to 320 (314 residues), 495.6 bits, see alignment E=2.2e-153 PF08003: Methyltransf_9" amino acids 7 to 322 (316 residues), 542.3 bits, see alignment E=9.5e-167 PF13489: Methyltransf_23" amino acids 121 to 270 (150 residues), 50.9 bits, see alignment E=4.5e-17 PF13847: Methyltransf_31" amino acids 122 to 228 (107 residues), 36.5 bits, see alignment E=1.2e-12 PF13649: Methyltransf_25" amino acids 126 to 220 (95 residues), 42.3 bits, see alignment E=3.1e-14 PF08241: Methyltransf_11" amino acids 127 to 224 (98 residues), 41.6 bits, see alignment E=5e-14 PF08242: Methyltransf_12" amino acids 127 to 222 (96 residues), 39.5 bits, see alignment E=2.4e-13

Best Hits

Swiss-Prot: 100% identical to CMOB_SHELP: tRNA U34 carboxymethyltransferase (cmoB) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K15257, tRNA (mo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to slo:Shew_2082)

MetaCyc: 63% identical to tRNA U34 carboxymethyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-7067

Predicted SEED Role

"tRNA (5-methoxyuridine) 34 synthase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEQ0 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Shew_2082 putative methyltransferase (RefSeq) (Shewanella loihica PV-4)
MISFSSFYQQIADSNLQHWLEELPAILGQWQREHKHGNLPKWEKVLNKLHYPAPDRIDFT
TRVEVGSGDQLSKGQQEKLKNLLKLFCPWRKGPFDLHGIHIDTEWRSDWKWERVQPHISP
LKNRTVLDVGCGSGYHMWRMLGDGAKRVVGIDPSPLFLCQFEAVKRLAGNDHPVHLLPLG
IEQLPPLDAFDTVFSMGVLYHRRSPIDHLLQLRDQLRTGGELVLETLVVDGDENTVLVPG
ERYGKMNNVWFLPSAKALEAWLKKADFVDVRCVDIDVTSLAEQRSTEWMPNESLVDYLDP
NDVSLTVEGYPAPKRATFIAVKNQPNKDLV