Protein Info for Shew_2081 in Shewanella loihica PV-4

Annotation: putative methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00740: tRNA (cmo5U34)-methyltransferase
  • amino acids 5 to 243 (239 residues), 342.5 bits, E=6.9e-107
• PF09243: Rsm22
  • amino acids 40 to 162 (123 residues), 23.4 bits, E=1.3e-08
• PF01209: Ubie_methyltran
  • amino acids 54 to 165 (112 residues), 35.4 bits, E=2.6e-12
• PF13847: Methyltransf_31
  • amino acids 57 to 167 (111 residues), 37.5 bits, E=7.3e-13
• PF00891: Methyltransf_2
  • amino acids 58 to 171 (114 residues), 22.6 bits, E=2.1e-08
• PF13649: Methyltransf_25
  • amino acids 61 to 159 (99 residues), 57.6 bits, E=6.2e-19
• PF08241: Methyltransf_11
  • amino acids 63 to 163 (101 residues), 49.8 bits, E=1.5e-16
• PF08242: Methyltransf_12
  • amino acids 63 to 161 (99 residues), 41.8 bits, E=5.3e-14

Best Hits

Swiss-Prot: 100% identical to CMOA_SHELP: Carboxy-S-adenosyl-L-methionine synthase (cmoA) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K15256, tRNA (cmo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to slo:Shew_2081)

MetaCyc: 60% identical to carboxy-S-adenosyl-L-methionine synthase (Escherichia coli K-12 substr. MG1655)
RXN0-7066

Predicted SEED Role

"tRNA (uridine-5-oxyacetic acid methyl ester) 34 synthase"

MetaCyc Pathways

• 5-(methoxycarbonylmethoxy)uridine biosynthesis (2/3 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A3QEP9 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Shew_2081 putative methyltransferase (RefSeq) (Shewanella loihica PV-4)
MNSTQDTIYAQACEHISDFQFDDRVAGVFSDMIRRSVPGYGQIINTLGDFADKCVTPNSK
IYDLGCSLGAATLSVRRRIEGRGCEIIAVDNSESMIERCKQNLSAYVSETPVDLICADIR
DIEIQDASMVILNFTMQFLAPEDRQTLIAKIYQGLKPGGILVLSEKLVFEDEPVQHLLDE
LHLDFKRANGYSELEISQKRSSLEHVMKPDTLPQHQQRLKAQGFSHFSVWFQCFNFASMV
AIK