Protein Info for Shew_2068 in Shewanella loihica PV-4

Annotation: electron transport complex protein RnfC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 870 TIGR01945: electron transport complex, RnfABCDGE type, C subunit" amino acids 13 to 453 (441 residues), 600.4 bits, see alignment E=7.8e-185 PF13375: RnfC_N" amino acids 14 to 115 (102 residues), 96.2 bits, see alignment E=4.4e-31 PF01512: Complex1_51K" amino acids 143 to 290 (148 residues), 161 bits, see alignment E=7.9e-51 PF10531: SLBB" amino acids 303 to 350 (48 residues), 31.2 bits, see alignment 6.5e-11 PF13237: Fer4_10" amino acids 382 to 434 (53 residues), 31.6 bits, see alignment 5.2e-11 PF12838: Fer4_7" amino acids 384 to 437 (54 residues), 35.4 bits, see alignment 4.9e-12

Best Hits

KEGG orthology group: K03615, electron transport complex protein RnfC (inferred from 100% identity to slo:Shew_2068)

Predicted SEED Role

"Electron transport complex protein RnfC" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEN6 at UniProt or InterPro

Protein Sequence (870 amino acids)

>Shew_2068 electron transport complex protein RnfC (RefSeq) (Shewanella loihica PV-4)
MLTLLEQIDKGTLWRIPGGIHPPEHKTLSNQSKISRLPLADHYLIPVPGVGENCTLAVKV
GDTVTKGQPLTLGEGFRHLPVHAPVSGRVVAIEERASNHASALPVLTCVIENDHQEKWIE
SVHTPLSLEQVAEMDNDDIIRRIQSAGIAGLGGAAFPTHIKLKPVSEIELLIINGVECEP
YITSDDKLMQESCDEIVRGIEIVHQLLSPKRIIVAIEDNKPEAVEQMGHALNRSQLPSHC
ARVSKIPTLYPSGGEKQLIQILTGQEVPSGAIPANLGILVQNVGTAYSIAQAVYRNMPLI
ERVVTLTGQNIAKPGNYWVPIGTPVEHLLEVGQFRGDANAPVIIGGPMMGYMLPNVAAPI
TKGTNCVLMPSEQEVAPPSPEQPCIRCGECAQACPAQLLPQQLFWHAKAQEYDKAASYNL
RDCIECGCCSYVCPSDIPLVEYYRVAKSALRQEAEEKKQAELAKQRFDSRTLRLEQEKQA
REEKAKQAAERRKAQMTGSDKDAVAAAMARIQAKKAAEAQASAGATTEKPQDKVAAAIAR
AKAKKAAQKTSSETETETSEQPASQVKGADNRESAAVSQKEKVAAAIARAKAKKAAQDTA
DTTEASQAPAQQGAETAPLSQKDKVAAAIARAKAKKAAQAGANDQQAATVEHRDEPIERT
GETAKPSESQSASTDDTEGTEKADAAAAKKAKIAAAIAKAKAKKAQLDAGASDEPDVMTP
AEDIEANSPEAIKKAKIAAAVAKAKAKKAQQAGAGDEPKAEITTDAEPAKAEANDDAEAG
SPEAIKKAKIAAAVAKAKAKKAAQASAGDEQLAPSESQTDIEDFADAEDVADTSSPEAIK
KAKIAAAVAKAKAKKLAKAEAETPNNEHKD