Protein Info for Shew_2064 in Shewanella loihica PV-4

Annotation: excinuclease ABC subunit B (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 672 TIGR00631: excinuclease ABC subunit B" amino acids 6 to 666 (661 residues), 1071.5 bits, see alignment E=0 PF04851: ResIII" amino acids 17 to 88 (72 residues), 34.8 bits, see alignment E=4.8e-12 PF17757: UvrB_inter" amino acids 160 to 250 (91 residues), 113.5 bits, see alignment E=1.3e-36 PF00271: Helicase_C" amino acids 443 to 546 (104 residues), 70.6 bits, see alignment E=4e-23 PF12344: UvrB" amino acids 553 to 594 (42 residues), 72.4 bits, see alignment 6.5e-24 PF02151: UVR" amino acids 635 to 667 (33 residues), 32.7 bits, see alignment (E = 1.4e-11)

Best Hits

Swiss-Prot: 75% identical to UVRB_VIBVU: UvrABC system protein B (uvrB) from Vibrio vulnificus (strain CMCP6)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 100% identity to slo:Shew_2064)

MetaCyc: 78% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEN2 at UniProt or InterPro

Protein Sequence (672 amino acids)

>Shew_2064 excinuclease ABC subunit B (RefSeq) (Shewanella loihica PV-4)
MSESAFDLVSQYAPAGDQPGAIKQLVDGLDAGLANQTLLGVTGSGKTFTIANVIKQMQRP
TIIMAPNKTLAAQLYGEMKEFFPNNAVEYFVSYYDYYQPEAYVPSTNTFIEKDASVNAHI
EQMRLSATKALLERRDVVLIASVSAIYGLGDPESYMKMLLHLRQGDFMGQREILQRLSEL
QYTRNDIELDRGTFRVRGEVIDIFPAESDKQAIRVELFDDEIDRLSLFDPLTGHILQRIA
RTTVYPKTHYVTPREKILAATEDIKQELRERKQYLLDNNKLIEAQRISERVQYDIEMMTE
LGYCSGIENYSRYLSGRRPGEGPPTLLDYLPADGLLILDESHVTVPQIGAMYKGDRSRKM
NLVEYGFRLPSALDNRPLKFEEFESLMPQTIFVSATPAQYELDKSDGEIAEQVVRPTGLL
DPEIEVRPVAIQVDDLLSEANKRVAVNERVLVTTLTKRMAEDLTEYLDEHGVKVRYLHSD
IDTVERVEIIRDLRLGVFDVLVGINLLREGLDMPEVSLVCILDADKEGFLRSERSLIQTI
GRAARNVNGKVILYADNMTKSMAKAIGETERRREKQREFNLANGITPKGVSKKIADVMDL
GDYNEHTAKVLPKYQKVAESRTTYAKQDASSLSHQIDELEKRMHQHARDLEFEQAAALRD
EVLALREALIKA