Protein Info for Shew_2056 in Shewanella loihica PV-4

Annotation: SecC motif-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF17775: YchJ_M-like" amino acids 36 to 131 (96 residues), 94.9 bits, see alignment E=4.5e-31 PF02810: SEC-C" amino acids 141 to 158 (18 residues), 34.5 bits, see alignment (E = 1.5e-12)

Best Hits

Swiss-Prot: 48% identical to Y1921_SHESR: UPF0225 protein Shewmr7_1921 (Shewmr7_1921) from Shewanella sp. (strain MR-7)

KEGG orthology group: K09858, SEC-C motif domain protein (inferred from 100% identity to slo:Shew_2056)

Predicted SEED Role

"UPF0225 protein YchJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEM4 at UniProt or InterPro

Protein Sequence (159 amino acids)

>Shew_2056 SecC motif-containing protein (RefSeq) (Shewanella loihica PV-4)
MINPSLPCPCGRSVKDKPLSYNQCCEPFHLGVIAPDPESLMRSRYSAFVLKLHKYLIATH
HPDYLDGLSVEMLDEENHTSWLGLSVNRSSSAQDAGMVEFHAWYQGSNGLNAIHEISDFV
KQDGRWWYTQGEQLVPKYPKRNAPCVCQSGKKFKQCCLK