Protein Info for Shew_2043 in Shewanella loihica PV-4

Annotation: cation diffusion facilitator family transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 25 to 353 (329 residues), 215.6 bits, see alignment E=4.4e-68 PF01545: Cation_efflux" amino acids 30 to 279 (250 residues), 125.2 bits, see alignment E=1.4e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2043)

Predicted SEED Role

"Cation efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEL1 at UniProt or InterPro

Protein Sequence (362 amino acids)

>Shew_2043 cation diffusion facilitator family transporter (RefSeq) (Shewanella loihica PV-4)
MSNVKDHLAPWQHSHQFANLNSDGERNTRYVLLLTLFTMIAEIVAGTVYGSMALLADGWH
MGTHAAAFLITLFAYHYAKKHANSPDFAFGTGKVSVLGGFTSAVALGLVALLMVVESVSR
LFNPEQIHFNEAIFVAVIGLTVNVISVFLLKDHHGHHHHHGHHHNHHHDHSHDHSHGHHH
DHSHEHDHSHEHDAHHHVHEHKHEKAHAHGDKGHHDHNLRAAYFHVMADALTSLLAIGAL
LFGKYLGLTWLDPVMGVVGAVIITSWAWGLMKQTGPILLDASIEKQYVNQMVELIEAEQD
HQVSDIHVWRVSADHYAAMVSIVSHAPKELDYFKQKLAKFERIDHLTVELITCRQTACQV
AE