Protein Info for Shew_2039 in Shewanella loihica PV-4

Annotation: GCN5-related N-acetyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 PF02629: CoA_binding" amino acids 11 to 102 (92 residues), 35.9 bits, see alignment E=3.7e-12 PF13380: CoA_binding_2" amino acids 13 to 140 (128 residues), 74.6 bits, see alignment E=3.2e-24 PF13607: Succ_CoA_lig" amino acids 156 to 293 (138 residues), 174.1 bits, see alignment E=4.7e-55 PF13549: ATP-grasp_5" amino acids 487 to 708 (222 residues), 250 bits, see alignment E=6.1e-78 PF13302: Acetyltransf_3" amino acids 740 to 878 (139 residues), 31 bits, see alignment E=1.3e-10 PF00583: Acetyltransf_1" amino acids 786 to 878 (93 residues), 34.8 bits, see alignment E=6.1e-12 PF13508: Acetyltransf_7" amino acids 806 to 879 (74 residues), 29.7 bits, see alignment E=2.4e-10

Best Hits

Swiss-Prot: 52% identical to LYSAC_SALTY: Peptidyl-lysine N-acetyltransferase Pat (pat) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K09181, hypothetical protein (inferred from 100% identity to slo:Shew_2039)

Predicted SEED Role

"Protein acetyltransferase" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEK7 at UniProt or InterPro

Protein Sequence (900 amino acids)

>Shew_2039 GCN5-related N-acetyltransferase (RefSeq) (Shewanella loihica PV-4)
MSQRTLHTLFKPKSVAIIGASNGAKRAGNVVMRNLLSSGFSGPIMPVTPKYDAVMGVLAY
PNIEALPLKPDLAIICTAASRVPAIVERLAQFGCKVAIINASGMANQLDEEGLNLLTLTR
AHAKRYGMRILGPNSLGMMLPNLGLNASLAHTSALPGKIAFVSQSAAICTTVLDWANNKG
IGFSSFISLGDATDIDFDELLDFLGRDSRTTAIMIYIDSVNEKRHFLSAARAAARNKPIL
VIKSGRSLEGTTAAKLHTGGEVGNDAVYEAAFRRAGMLRVNDLVELFAAVETLAHSAPLQ
GERLAILSNGGGPAVLGLDQLILGGGKAATLDDDTFDKLNALLPDTWSGQNPVDIGGDAD
AKRYTQSLDILMNADVADAILVLHSPSALGDSIEIADSIIELVSKHPRRHKVNVLTNWSG
EDSAYQARKHFNRAGVPTYRTPEGAVGAFMHMVEYRRNQKLLQEVPQSIPDNIPTDAQLA
RSLLQRAIADNKQVIETHEASAILKAYGLNTIETHFAASAERAAEIAEQIGYPVALKVQS
PDIHHKSDVHGVMLNLTSHQEVLQAADAMVGRVHSINQDADIQGLIVQKMALTAGTQEIR
VAVTHDPVFGPAILLGEGGSEWQPSTDAAVALPPLNMTLARYMVIQALKTHKLKDRHLPL
GLDMNALCVMLTQISHLIIDCPEISGLDLNPVLCAGEQITLLDVNIQLNANAQDNTNRLA
ICPYPKELEEHAVLKNGLEIMLRPILPEDEPKHLAFDNSLSDEDRYKRYFGVRSKMTHEE
MAVLTQIDYAREMAFIATTKGADGDDITLGAVRASIDPDNTEAEFAMAVRSDHQGIGIGK
LLLEKLIAYYKANDTELLTGFTMFENRNMASLAKKLGFSVTFDMEEHLIKMDMPLKPKQD