Protein Info for Shew_2002 in Shewanella loihica PV-4

Annotation: glyceraldehyde-3-phosphate dehydrogenase, type I (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF00044: Gp_dh_N" amino acids 3 to 106 (104 residues), 137 bits, see alignment E=3.8e-44 TIGR01534: glyceraldehyde-3-phosphate dehydrogenase, type I" amino acids 4 to 327 (324 residues), 425.2 bits, see alignment E=9.1e-132 PF03447: NAD_binding_3" amino acids 9 to 123 (115 residues), 24.4 bits, see alignment E=6.4e-09 PF02800: Gp_dh_C" amino acids 159 to 315 (157 residues), 210.8 bits, see alignment E=1.3e-66

Best Hits

Swiss-Prot: 70% identical to G3PC_CUPNH: Glyceraldehyde-3-phosphate dehydrogenase, chromosomal (cbbGC) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 100% identity to slo:Shew_2002)

MetaCyc: 54% identical to Gap (Thermotoga maritima)
Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). [EC: 1.2.1.12]

Predicted SEED Role

"NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Pyridoxin (Vitamin B6) Biosynthesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.12

Use Curated BLAST to search for 1.2.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEH0 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Shew_2002 glyceraldehyde-3-phosphate dehydrogenase, type I (RefSeq) (Shewanella loihica PV-4)
MTIRVAINGYGRIGRNVLRALYESEKQYPIQIVAINDLGDASINAHLTKYDSVHGRFNAK
VEHDDEAIYVNEDKIKTFSERDPAKLPWAELEVDVVFECTGIFTSKEAVQPHLNAGAKKV
IISAPGKNVDATVVYGVNNDVITSDMTVISNASCTTNCLAPFAKPLNDEIGIESGLMTTI
HAYTNDQRLSDVYHTDLRRARAAAMSMIPTKTGAAAAVGLVVPELAGKFDGMAVRVPTVN
VSLVDLSFVAARDTTVEEINAIIEKAASVAPMSEVLSVNKEPLVSIDFNHNPFSSNFDAT
QTRVNGRLVKVMAWYDNEWGFSNRMLDNAVALMTAK