Protein Info for Shew_1995 in Shewanella loihica PV-4

Annotation: PP-loop domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF01171: ATP_bind_3" amino acids 42 to 202 (161 residues), 49.4 bits, see alignment E=2.4e-17

Best Hits

Swiss-Prot: 100% identical to TTCA_SHELP: tRNA-cytidine(32) 2-sulfurtransferase (ttcA) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K14058, tRNA 2-thiocytidine biosynthesis protein TtcA (inferred from 100% identity to slo:Shew_1995)

MetaCyc: 67% identical to tRNA cytosine32 2-sulfurtransferase TtcA (Escherichia coli K-12 substr. MG1655)
2.8.1.M2 [EC: 2.8.1.M2]

Predicted SEED Role

"tRNA(Cytosine32)-2-thiocytidine synthetase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEG3 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Shew_1995 PP-loop domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MSEETLSKKQITRLNKLQKRLRREVGSAIADYNMIEEGDTVMCCLSGGKDSYAMLDILVN
LLQRAPVNFNLVAVNLDQKQPGFPEDILPAYLDSLKVPYHILEKDTYSIVKDKIPEGKTT
CSLCSRLRRGTLYGFAQKIGATKIALGHHRDDIIETMFLNMFYAGKLKAMPPKLLSDDGA
NVVIRPLAYSREKDIAEYAELKAFPIIPCNLCGSQENLKRAAVKEMLKSWDKQFPGRIET
IFTAMQNTSPSQGVDRDQFDFVSLKQDPDAPMKGDVAESDLPAFDFLDLANSGHIDLDAA
KRSSDLLKIDVVSTYTP