Protein Info for Shew_1970 in Shewanella loihica PV-4

Annotation: histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 transmembrane" amino acids 278 to 297 (20 residues), see Phobius details amino acids 437 to 455 (19 residues), see Phobius details PF12974: Phosphonate-bd" amino acids 2 to 253 (252 residues), 94.9 bits, see alignment E=7.9e-31 PF00512: HisKA" amino acids 341 to 400 (60 residues), 34.8 bits, see alignment 2.1e-12 PF02518: HATPase_c" amino acids 446 to 570 (125 residues), 68.2 bits, see alignment E=1.3e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1970)

Predicted SEED Role

"Tetrathionate reductase sensory transduction histidine kinase" in subsystem Tetrathionate respiration

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QED8 at UniProt or InterPro

Protein Sequence (576 amino acids)

>Shew_1970 histidine kinase (RefSeq) (Shewanella loihica PV-4)
MGALAFAAPEIVYQRWAPTLARVTKETGIELELVPLRPDELVERVSNSSLDFIIGNALIT
VAFKKDYGVSHLLTLVPLNHANPEQAVGTALISRSSLEINTLSDLEGLRVVSSDPNAFGG
FQIIAGEMITAGIDPLNDLRQLEFVGFPQEKLLDFLREDRADVAILPSCVLESAIAQGKL
TRGELHVLLPQFHPGFSCQASSSLYPGYAFSKLGKTDHDVARQIVRALLDIESQDQQAIL
GRYHTWSVPVDDSQVFTLLQQLDRWPFVTNWQRLAEDAIPWALVIAIILALGYLHHLRVK
RLVKKRTQALSDEMTQHKNTQKRLFEQQQQFYRAQRVLLTGEMASGIAHELNQPLAGIRY
LAQGSIYRLLAQQTELQHALSKILQQVDRAQNTIKRFRQFCQQPSVYQDCDLKELIQDTL
NLMQPDFKRIDFNPKLFLWPLTVTLDISLMQQVFVNLIRNALDAMDETDDPQLAIAITND
SENAVIVVSDSGIGLSEQALERLFFPFETSKANGLGLGMVVCKRIVEEHGGKIRAFNNHE
ASRTQHLPKELGDEFPRFATGLTLVITLPLKENVHV