Protein Info for Shew_1959 in Shewanella loihica PV-4

Annotation: short chain dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF00106: adh_short" amino acids 7 to 194 (188 residues), 151.8 bits, see alignment E=3.3e-48 PF23441: SDR" amino acids 8 to 249 (242 residues), 52.5 bits, see alignment E=9.4e-18 PF08659: KR" amino acids 9 to 169 (161 residues), 34.9 bits, see alignment E=3.1e-12 PF13561: adh_short_C2" amino acids 15 to 250 (236 residues), 199.7 bits, see alignment E=1.2e-62

Best Hits

Swiss-Prot: 42% identical to DECR2_DANRE: Peroxisomal 2,4-dienoyl-CoA reductase (decr2) from Danio rerio

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1959)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEC7 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Shew_1959 short chain dehydrogenase (RefSeq) (Shewanella loihica PV-4)
MFDYQGKNVFVVGGTSGINLGIAKAFAKAGANVAVASRRQEKVDAAVEALREINGQGKML
GVAFDVRDLEALKTGFKQIADAYGQLDVLVSGAAGNFPATAAELSENGFKSVMDIDLLGS
FQVLKQAYPLMRRPGGAIVQISAPQAYIAMPMQSHVSAAKAGVDMLTKSLALEWGIEGIR
VNSIVPGPISGTEGFSRLAPSDALQQAVAQSVPLKRNGSTDDIANAVMFIASEMASYITG
TVLPVDGGWSLGGASMAMSQLGKMAQQPKEN