Protein Info for Shew_1950 in Shewanella loihica PV-4

Annotation: phosphoserine aminotransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF00266: Aminotran_5" amino acids 5 to 351 (347 residues), 171.7 bits, see alignment E=1.2e-54 TIGR01364: phosphoserine transaminase" amino acids 5 to 362 (358 residues), 491.7 bits, see alignment E=5.4e-152

Best Hits

Swiss-Prot: 82% identical to SERC_SHEWM: Phosphoserine aminotransferase (serC) from Shewanella woodyi (strain ATCC 51908 / MS32)

KEGG orthology group: K00831, phosphoserine aminotransferase [EC: 2.6.1.52] (inferred from 100% identity to slo:Shew_1950)

Predicted SEED Role

"Phosphoserine aminotransferase (EC 2.6.1.52)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 2.6.1.52)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEB8 at UniProt or InterPro

Protein Sequence (364 amino acids)

>Shew_1950 phosphoserine aminotransferase (RefSeq) (Shewanella loihica PV-4)
MSATYNFCAGPAMLPQPVMQKAQEELLDWNGQGVSVMEISHRSKEFIALTEQAEADIRDL
MNIPSNYHVLFMHGGGRGQFAAVVNNLLGEQGKALYLVDGSWSSAAVEEAKKLAGDAQID
TLNIVEKTNGISRIVVPDLNEIKQDYRYLHYCPNETVDGIEIFEEINSPWPIVADMSSNI
MSREIDVSRYGLIYAGAQKNIGPSGLSIVIVRDDLLAYPQLTQASIMDYRLAVKHDSMFN
TPPTFAWYLAAEVFKWLKAQGGVAEVAKVNDRKAETLYAYIDSGDFYENRVAVANRSKMN
VTFYLKDESLNEPFLAEAKAAGLVALKGHRSVGGMRASLYNAMPLVGVEALVSFMKAFAE
KHVA