Protein Info for Shew_1941 in Shewanella loihica PV-4

Annotation: signal peptide peptidase SppA, 67K type (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 613 transmembrane" amino acids 25 to 44 (20 residues), see Phobius details TIGR00705: signal peptide peptidase SppA, 67K type" amino acids 16 to 606 (591 residues), 597.9 bits, see alignment E=1.8e-183 PF01343: Peptidase_S49" amino acids 136 to 279 (144 residues), 95.9 bits, see alignment E=3.6e-31 amino acids 391 to 541 (151 residues), 165.7 bits, see alignment E=1.2e-52 TIGR00706: signal peptide peptidase SppA, 36K type" amino acids 350 to 540 (191 residues), 182.6 bits, see alignment E=7.6e-58 PF01972: SDH_sah" amino acids 351 to 429 (79 residues), 24.2 bits, see alignment E=2.5e-09

Best Hits

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 100% identity to slo:Shew_1941)

Predicted SEED Role

"Signal peptide peptidase SppA (EC 3.4.21.-)" (EC 3.4.21.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEA9 at UniProt or InterPro

Protein Sequence (613 amino acids)

>Shew_1941 signal peptide peptidase SppA, 67K type (RefSeq) (Shewanella loihica PV-4)
MSAKPSIFKRIFSTLWKVVNTTRKVILNLFFFGFIALLFVILAGEESPTVEEGSALVLDL
SGNVVEQKRQVDPIEAAMKSGKGGQSDGEILLADLLNAIDNAASDKRISALVLDIGHLRW
TGISKLQSIGDALTRFKASGKPIIAMGNWYGQNQYFLASFADTIYLNPQGSVEIEGLSRY
RQYFKSALDKLKIKAHVFRVGTFKSAVEPFMRDDMSEAAKSANRELLQDIWDSFEATVSE
NRGIKQDDLMLSAERYLTELNKANGRSSEMAINLGWVDKLASAEQFRLDMVERVGEAKEG
HSFKQISFYDYQSVIQQFPPVLMHDAVGIIVAKGNILNGHQAAGQIGGESTSALLRKARF
DDKVKAVVLRVDSPGGSAFASEQIRQEVLALKAANKPVVVSMGTYAASGGYWISASADYI
YATPTTLTGSIGIFGMMTTFEDSLAELGIHTDGVSTSGWTAFSSTQGISDELKEIIQRHI
ERGYQDFISLVSEERGMKPEEVDKIAQGRVWSGKRALELGLVDELGDLEQAVTKAAELAK
LEKFDTKLIEQELSPQEQFIQQMFAQAVSYMPQSLSQSSLIEQLLGEVSSVVEEFNAFDD
PNGIYLYCDSCNY