Protein Info for Shew_1933 in Shewanella loihica PV-4

Annotation: endonuclease/exonuclease/phosphatase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details PF03372: Exo_endo_phos" amino acids 74 to 278 (205 residues), 44 bits, see alignment E=1.1e-15

Best Hits

Swiss-Prot: 40% identical to Y2298_VIBPA: UPF0294 protein VP2298 (VP2298) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1933)

Predicted SEED Role

"FIG01059134: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEA1 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Shew_1933 endonuclease/exonuclease/phosphatase (RefSeq) (Shewanella loihica PV-4)
MSQNRSNSPRLLRWGIKSLLLLLLSAAAYVAVVTYLNGEPEVMMSEVEPVFVSQCVAAHT
SQALDNDGLLRVGVWNIYKQQKRGWQQALSKIAERSEIMLLQEAKLNAGFNQYLNGSSLH
LVMAKAFSLLKSPVGVMNLATEQARDACAYHAVEPWIRFAKSTLISRYSLSNGQTLLVVN
LHGINFDWQLKSYRAQWQQIVQKINLHQGPVILGGDFNTWRGQRMAYIEQLAHQLRLKEA
VYEEDKRQRVFGLPLDHLYYRGLNLVAAESFTSQASDHNPIWAEFRLKPVAH