Protein Info for Shew_1932 in Shewanella loihica PV-4

Name: cls
Annotation: cardiolipin synthetase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details TIGR04265: cardiolipin synthase" amino acids 39 to 532 (494 residues), 493.3 bits, see alignment E=4.5e-152 PF13396: PLDc_N" amino acids 50 to 87 (38 residues), 27.6 bits, see alignment 3.6e-10 PF13091: PLDc_2" amino acids 162 to 271 (110 residues), 50.2 bits, see alignment E=3.6e-17 amino acids 372 to 493 (122 residues), 98.7 bits, see alignment E=3.7e-32 PF00614: PLDc" amino acids 248 to 272 (25 residues), 32.8 bits, see alignment (E = 7.2e-12) amino acids 446 to 472 (27 residues), 30.6 bits, see alignment (E = 3.6e-11)

Best Hits

KEGG orthology group: K06131, cardiolipin synthase [EC: 2.7.8.-] (inferred from 100% identity to slo:Shew_1932)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QEA0 at UniProt or InterPro

Protein Sequence (532 amino acids)

>Shew_1932 cardiolipin synthetase (RefSeq) (Shewanella loihica PV-4)
MIAIRLYLDSTPLSNHTRASAIQAQADIMENVHQILAIAGVFIYWLFLGAIALRLVIKRR
TIGVSFSWILVIYFLPLVGIIAYILFGESHLGQTRASRSKAMFKPYGQWFAALYQHPLHT
PERQSDHARAISQLCDTQLGIPSLSGNQLCLQHTPSSILNSIIQDIDAAKESIVMEFYIW
HPGGLADDVARAVIKASKRGVIVKLLLDAAGSRTFFNSPWPTQLRKAGIEISQALSVSPL
RMFFRRLDLRLHRKIVVIDNHIAYTGSMNLVDPKYFKQGEGVGQWIDVMVRMVGPAVPLV
NTVAAWDWEVETSERYLPEPPGNPEKPYELSHEISYELSCEPSGEVRREADSLVQVIPSG
PGMPEEVIHQVLLQSLYQACRKIVITTPYFVPSENLLDALVTAAARGVDVNIIIPQKNDS
TMVKWASRSFFAELLKAGVKIHRFRGGLLHTKSVLIDDEHSLIGTVNMDMRSLWLNFELT
LAVDDKVFAEELRVLQQGYIDNAEQLEYKRWQSRPLYQRVIEHLFYLFSPLL