Protein Info for Shew_1911 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 5 to 202 (198 residues), 203.5 bits, see alignment E=1.5e-64 PF01914: MarC" amino acids 6 to 207 (202 residues), 196.8 bits, see alignment E=1.4e-62

Best Hits

Swiss-Prot: 52% identical to YCHE_ECOLI: UPF0056 membrane protein YhcE (ychE) from Escherichia coli (strain K12)

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 100% identity to slo:Shew_1911)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QE79 at UniProt or InterPro

Protein Sequence (213 amino acids)

>Shew_1911 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MTLDLTLYVKFFLGLVAIINPIGLLPVFVSLTSHQTEAERNHTGKVANFAVVVILLVTII
AGQHILNMFSISLSAFRIAGGTLIAIIAMSMLQGKLGEVKRNQEEDREASGMESVAVVPL
ALPLMAGPGAISSVIVSAAQHNTFSDLIGMSITVVIFGLTSFTLFRMAPVIFKLLGKTGI
NVITRLMGLLMLSIGIEVMAAGFKGLFPSLIGS