Protein Info for Shew_1902 in Shewanella loihica PV-4

Annotation: NUDIX hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 PF00293: NUDIX" amino acids 28 to 152 (125 residues), 63.7 bits, see alignment E=9e-22

Best Hits

Swiss-Prot: 42% identical to NUDL_PHOLL: Uncharacterized Nudix hydrolase NudL (nudL) from Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1902)

Predicted SEED Role

"Hypothetical nudix hydrolase YeaB" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QE70 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Shew_1902 NUDIX hydrolase (RefSeq) (Shewanella loihica PV-4)
MTLDEFKRRYALHQLPTDTGPQIHRTLRQAAVLVPLMEASGELELLLTRRPTHLRAHPGQ
ISFPGGKVEESDASYADTALREAFEEIALPRDNVEVLGQYPMFNTFTGFAIAPIIGVVRE
AFEPVLDPGEVDELFSVPLSFLLNPANRIQKQFSRRGVNYPVYFIPYGDYFIWGATAAMI
DRLCRQIGN