Protein Info for Shew_1895 in Shewanella loihica PV-4

Annotation: redoxin domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 signal peptide" amino acids 1 to 46 (46 residues), see Phobius details PF00578: AhpC-TSA" amino acids 45 to 159 (115 residues), 68.2 bits, see alignment E=1.7e-22 PF08534: Redoxin" amino acids 45 to 171 (127 residues), 69.8 bits, see alignment E=5.6e-23 PF00255: GSHPx" amino acids 50 to 107 (58 residues), 30.5 bits, see alignment E=5.6e-11 PF13905: Thioredoxin_8" amino acids 68 to 157 (90 residues), 46.6 bits, see alignment E=8.7e-16 PF00085: Thioredoxin" amino acids 69 to 117 (49 residues), 32.6 bits, see alignment E=1.6e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1895)

Predicted SEED Role

"Thioredoxin family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QE63 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Shew_1895 redoxin domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MSREQKMQGVQPSVEGRMRSPMMAKLLWLSMAMLVSLSMVQPSHAAPRLDLSAKTQSGEL
VSLESYKGKVVYVDFWASWCAPCRDSFPWMELMHQRYGDKGLAIVAINLDEESEMAGPFL
ADFKTSFDILYDPKGEMAGHFNLQGMPSSYLFDAEGNLVSEHLGFFKSKQAAVEQEIQSL
LKKRSADAN