Protein Info for Shew_1891 in Shewanella loihica PV-4

Annotation: Fmu (Sun) domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 PF22458: RsmF-B_ferredox" amino acids 137 to 202 (66 residues), 43.1 bits, see alignment E=7.5e-15 PF01209: Ubie_methyltran" amino acids 226 to 299 (74 residues), 23 bits, see alignment E=9.6e-09 PF01189: Methyltr_RsmB-F" amino acids 236 to 396 (161 residues), 140.6 bits, see alignment E=1.1e-44 PF13847: Methyltransf_31" amino acids 236 to 370 (135 residues), 29.7 bits, see alignment E=9.9e-11

Best Hits

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 100% identity to slo:Shew_1891)

Predicted SEED Role

"Sun protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QE59 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Shew_1891 Fmu (Sun) domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MIASDFYYLGSTMLNASLSPSSTELVINVLAMVLEEGKPLDRAYSHHFSGLKLAPSEQAR
ITYVTGDLLRRLNFYCYLADISTDEIARMGSRLLNAWHMANELPIPKLQYTLAIEEDDFY
QRLEAAKQQAALFDGCPEWLDTLGQEQLGDDWAKERAALAQAPKRYLRVNPLKTNSEDLA
KRLAKEGVETREVPGVPSALEVISDAALFRTECFKQGLFEQQDAGSQHVAAAVGAEPGMR
VIDACAGAGGKTLAIAAQMQGKGRLLAMDVEQWKLDNLKQRARRAGAHNVETRIIASSKT
IKRLKLSADRVLLDVPCSGLGVLKRNPDAKWRDTPDRLPVLVELQREILQSYSRMVKVDG
ILIYATCSIMPQENRQQVDAFLAANPHFSFIDDETVSVADTGFDGFYLARMKRTAESA