Protein Info for Shew_1844 in Shewanella loihica PV-4

Annotation: chromosome replication initiation inhibitor protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 TIGR03298: transcriptional regulator, ArgP family" amino acids 2 to 293 (292 residues), 370.1 bits, see alignment E=3.5e-115 PF00126: HTH_1" amino acids 6 to 61 (56 residues), 59.5 bits, see alignment E=2.5e-20 PF03466: LysR_substrate" amino acids 93 to 268 (176 residues), 44.8 bits, see alignment E=9.7e-16

Best Hits

Swiss-Prot: 46% identical to ARGP_VIBCH: HTH-type transcriptional regulator ArgP (argP) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K05596, LysR family transcriptional regulator, chromosome initiation inhibitor (inferred from 100% identity to slo:Shew_1844)

Predicted SEED Role

"Chromosome initiation inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QE12 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Shew_1844 chromosome replication initiation inhibitor protein (RefSeq) (Shewanella loihica PV-4)
MLDYAHLKALSVVIAEGGFERAAKALFITQSAVSQRIKTLEERVGQTLVIRSNPVQATPM
GKRLLRHYAQVSLLESELSAEIDADDPSLPTVVKIAVNADSLATWFLPALAELFKRHRWL
LELVVDDESYTHHLLKSGEAVGCVTTTEAPLAGCSSEYLGQMEYLCVATQDFIQEYFADG
VTPSRLRQAPAVVFSTKDKLHEKFLGEHFGIEPEQWREHQIPSSESFLEAILLGMGYGLV
GHLQAEPLLQSGALKLIAPDCTMKVPLYWQHWNIKAKQTTLVYRALAATAKQALR