Protein Info for Shew_1840 in Shewanella loihica PV-4

Annotation: arsenate reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00014: arsenate reductase (glutaredoxin)
  • amino acids 9 to 120 (112 residues), 143.4 bits, E=2e-46
• PF03960: ArsC
  • amino acids 13 to 118 (106 residues), 71.1 bits, E=3.9e-24

Best Hits

Swiss-Prot: 62% identical to YFGD_ECOLI: Uncharacterized protein YfgD (yfgD) from Escherichia coli (strain K12)

KEGG orthology group: K00537, arsenate reductase [EC: 1.20.4.1] (inferred from 100% identity to slo:Shew_1840)

MetaCyc: 39% identical to arsenate reductase (Escherichia coli K-12 substr. MG1655)
Arsenate reductase (glutaredoxin). [EC: 1.20.4.1]

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

• arsenate detoxification III (1/2 steps found)
• arsenic detoxification (bacteria) (2/4 steps found)
• arsenate detoxification I (3/6 steps found)
• arsenic detoxification (plants) (2/6 steps found)
• arsenic detoxification (yeast) (3/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Sequence Analysis Tools

See A3QE08 at UniProt or InterPro

Protein Sequence (120 amino acids)

>Shew_1840 arsenate reductase (RefSeq) (Shewanella loihica PV-4)
MDRTAMTQVSIIHNPRCSKSRQTLALLEEKACDIQVIEYLKTPLTKVEIRSILDKLGLAP
RELMRTKEEEYKALNLADVTDDEALIQAMVDTPKLIERPIVLANGKAAIGRPPENVLAIL