Protein Info for Shew_1838 in Shewanella loihica PV-4
Annotation: DNA replication initiation factor (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 52% identical to HDA_ESCF3: DnaA regulatory inactivator Hda (hda) from Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
KEGG orthology group: K10763, DnaA-homolog protein (inferred from 100% identity to slo:Shew_1838)Predicted SEED Role
"DnaA regulatory inactivator Hda (Homologous to DnaA)"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A3QE06 at UniProt or InterPro
Protein Sequence (236 amino acids)
>Shew_1838 DNA replication initiation factor (RefSeq) (Shewanella loihica PV-4) MSPHSPVQLSLPVYLPDDETFNSYYPAAGNDELILSLQASAEGRANKAVYLWGPVKAGRT HLMHATCARANELNRSSFYLPLGIHASISTELLEGLEQLDLVCIDDVDAIAGHPLWEEAL FDLYNRVAEHKRCALVVSASATASDAGFALPDLVSRMQWGLTYQLQPMADEEKLAALQRR AAMRGLQLPEDVGRFLLNRLARDLRTLFDVLDRLDKASLVHQRKLTIPFVKEMLRL