Protein Info for Shew_1808 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 767 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 322 to 346 (25 residues), see Phobius details amino acids 355 to 379 (25 residues), see Phobius details amino acids 405 to 424 (20 residues), see Phobius details amino acids 611 to 629 (19 residues), see Phobius details amino acids 634 to 653 (20 residues), see Phobius details amino acids 661 to 684 (24 residues), see Phobius details amino acids 709 to 729 (21 residues), see Phobius details amino acids 738 to 763 (26 residues), see Phobius details PF03176: MMPL" amino acids 152 to 404 (253 residues), 41.4 bits, see alignment E=9e-15 amino acids 548 to 762 (215 residues), 53.8 bits, see alignment E=1.6e-18 PF02460: Patched" amino acids 164 to 307 (144 residues), 37.5 bits, see alignment E=9.2e-14

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 100% identity to slo:Shew_1808)

Predicted SEED Role

"FIG005548: transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDX6 at UniProt or InterPro

Protein Sequence (767 amino acids)

>Shew_1808 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MLDKLVNGLESFLFRQRAYVIFAFLLATLFLGFQASHLKMDAAFVKNIPLNHSYMQTYLK
HQKQFGGANSIMVAVEDSSGNIFNPNFFDTLKQVHDQLFFIPGVDRAQVKSLYSPSTRFT
EVVEDGFAGGPVIPADFSTTPAGLEVVRSNIEKAGIVGRLIAEDYSAAMVTAQLMDFDPQ
TGEPLDTLAFASQLEKELRGQYENDKIKIHIIGFAKMAGDVAEGAKGVVLFFAIAILVTA
VMVYLFSHSVKLTLLPLVCSLVAVVWQLGLLTVVGFGLDPMSILIPFLVFAIGVSHGVQM
INAVRRRVGEGETTKAAAALAFRSLLIPGGVALLSDTVGFMTLLAIDIGIIRELAISASL
GVAVIILTNLVLLPLLISFTEVKALPTKSNGKVDALWRKLSNFATPKYAVIVLLATVALY
GVGLQQASKMKIGDLQGGAPALHFDSRYNQDTFYITDHFSITTDVMTVIVEAFPEACTYH
DVLTQIDEFEWLVANTPGVESTASLASIAKRVNAGFNEGNPKWQVLPRTTASLVQAVGQI
PTTSGLLDGNCSVMPVYLFLKDHKAETIEQVIDKVKTLSAKMDSDKLKFKLASGPVGVMA
ATNEAVAEAQLPMMLYVYGAVFVLCLISFRSIRATVAVILPLYVVSTLAQALMTQLDIGL
AVSTLPVIALGVGIGVDYGIYILSTMAVKLRDGMPVQTAYHQALIERGSAVIFTGLTLAI
GVSTWFFSALKFQMDMGILLTFMFLVNMLGAIIILPAIGAVFWRKPR