Protein Info for Shew_1798 in Shewanella loihica PV-4

Annotation: paraquat-inducible protein A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 58 to 79 (22 residues), see Phobius details amino acids 108 to 137 (30 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details PF04403: PqiA" amino acids 60 to 216 (157 residues), 137.8 bits, see alignment E=1.5e-44

Best Hits

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 100% identity to slo:Shew_1798)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDW6 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Shew_1798 paraquat-inducible protein A (RefSeq) (Shewanella loihica PV-4)
MTLDDRKRPRTDMKTEVLDKSIVLCRACDLVVRKRALPTGVRALCPRCHTNLYDTPYCSL
NGMLALCITALVLYFPANFFPVLEMHFLGSIRTTTIAGGAMAVASQGYWVVGIAVLVAAV
IAPGLLILSILTQVLIVKYRLKVPFFRNIYKKLLKQHSLLAQLSMLEIYMISIFVSVFQL
SDYTDLYFGIGTFCFTMLFIMVIFMQREYDIEHMWGVLDE