Protein Info for Shew_1790 in Shewanella loihica PV-4

Annotation: integral membrane sensor signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 723 signal peptide" amino acids 6 to 11 (6 residues), see Phobius details transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 422 to 442 (21 residues), see Phobius details TIGR03785: proteobacterial dedicated sortase system histidine kinase" amino acids 8 to 720 (713 residues), 1137.2 bits, see alignment E=0 PF00512: HisKA" amino acids 500 to 562 (63 residues), 41.4 bits, see alignment E=1.2e-14 PF02518: HATPase_c" amino acids 609 to 722 (114 residues), 51.3 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1790)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDV8 at UniProt or InterPro

Protein Sequence (723 amino acids)

>Shew_1790 integral membrane sensor signal transduction histidine kinase (RefSeq) (Shewanella loihica PV-4)
MFNLPIGLRTKVAVLSLFLLCLPWLGYQYVWEMEKYLRHGQEKTLEGTTQALATALHERP
KLFDKQASFLSQVKKGRDLYAYPLTGPIHLDGKLGEWASNRHRAVTYGADHQLFKADDGK
PLNISFTHMVGKYAGYLYGYFEVTDPKVIYRGTNSLRIDNNDHLAIATLAPDGQFRRYIV
ATIRDGWISAFELPADPRKSQPVTPEVRIQGKWLKTEKGYNIELRMPLEMVGSKLGFAIV
DVNDRKARNVEAIVGTSATDDVTKLGTVLVPSPEIESIIKGMSHNSSRIWVVDRHGRVLA
KSGDIYSSTNVWAQTATEQTPDTFWGRFKQQFLHPLYYRILTTPPKHFVDSLKDSTVLEG
SHIRKALAGQFGSTWRLSPDGKAVILAAASPIWIDDTVMGVVIAEETTHGIRTLRNKALE
KLFNVILTVMSMGTLALFFFASSISSRIRKLRDDAEQAIDSQGRIRKAIVGSKVRDEIGD
LSRSFASIVGRLSQYTHYLENMSSRLGHELRTPVAVVRSSLEHLNSQDLPPQHQKYVDRA
HEGVSRLNMILNNMSEATRLEEALTDAEVDNFPLSKVISGCMQGYQMTYANQVFELEIDK
EPMTMRGVPEYIAQLMDKLIANAIEFSQSDTPIKVSLKAKGRQALLSVSNLGPSLPANMG
EQIFESMVSVRAQKAQDKPHLGLGLYIARLITDFHKGSIRAENLMQDGQATGVVIHIRLP
LEA