Protein Info for Shew_1784 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 35 to 52 (18 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 254 to 271 (18 residues), see Phobius details amino acids 278 to 295 (18 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details PF11168: DUF2955" amino acids 15 to 154 (140 residues), 145.7 bits, see alignment E=4.3e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1784)

Predicted SEED Role

"Permease of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QDV2 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Shew_1784 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MLIRHHPLSANDLRQCLRIATGATLGFLSCKVLEFNYGVFFTVLPMLMLGILPKMSLHVV
RQVMASSAIAIIEVALLAEYLGSHPIVMSIVAFLLFLYRFACMSRGSLFLFGATGVISLS
IMLHFASYPDTDVTELAINNFMGCGFSVLIAYLMMYLFPDVDARAPMAAMPKAPHRMRHE
ALMGATIATISFAVFQVFDLRDSLAAQATTLLLLFPMHWNGALGYARRRAVGTILGVTCG
LLMQLLLYTWAHELVLLLPLFWLVTLLFSQAHVTEAMGSGVGFGAMTTMGALYGQNLTPA
NDLIYSSLYRGASILGAIVLTLMACYLVHLLLNRFEATRFGH